PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01689.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family TALE
Protein Properties Length: 425aa    MW: 46255 Da    PI: 8.76
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01689.1_g00002.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.5e-092212532254
                              SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                 Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                              ++yp+ +++  LAk++gL+ +qV++WF N R +
  Rsa1.0_01689.1_g00002.1 221 HPYPTDTDKLMLAKQTGLSRNQVSNWFINARVR 253
                              89*****************************87 PP

2BELL82.55.3e-271011551872
                     BELL  18 eVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                               V+krYkqy+eqlq+v++sFe+vaglg+a+pY+sl lk +S+hF+cLk+ai++q+
  Rsa1.0_01689.1_g00002.1 101 DVYKRYKQYYEQLQAVMGSFECVAGLGHAAPYASLTLKVLSKHFKCLKNAITDQL 155
                              699*************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.7E-1341153IPR006563POX domain
PfamPF075264.0E-19102152IPR006563POX domain
CDDcd000861.41E-11197258No hitNo description
SMARTSM003894.0E-9197261IPR001356Homeobox domain
SuperFamilySSF466895.13E-17199264IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.6E-27201261IPR009057Homeodomain-like
PfamPF059201.2E-18214253IPR008422Homeobox KN domain
PROSITE profilePS5007111.645216257IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 425 aa     Download sequence    Send to blast
MSDAYEPYHV LQQSRRDKLR LPSLDSHFHF HHPLPPPPSS SGGVFPTADS DFLAAGGGFH  60
SNSNNNPSYS NFMGFLGGPS SSSSTAVAVD HSFNAGLSSG DVYKRYKQYY EQLQAVMGSF  120
ECVAGLGHAA PYASLTLKVL SKHFKCLKNA ITDQLQFSTN NKIQQQQFLE FGGNDSSRGL  180
CSAGQRHGFP DHHAPVWRPH RGLPERAVTV LRAWLFDHFL HPYPTDTDKL MLAKQTGLSR  240
NQVSNWFINA RVRVWKPMVE EIHMLETRQS QKSSSSWRDT TTVFPDHNNN PSSSTAQQAN  300
NSSSPARRVR NDDVHAITNN NNNRFMNAGN GGNVGGGGAV NFSYGIASSN VPGMNTSTNG  360
GVSLTLGLHH QIGLPEPFPM TTAQRFGLDA GSSGGGGGGY EGQDRSFGRD FIGGSNHQFL  420
HDFVG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5bng_A2e-16203261159Homeobox protein Meis2
5bng_B2e-16203261159Homeobox protein Meis2
4xrs_B2e-16203260158Homeobox protein Meis1
4xrs_A2e-16203260158Homeobox protein Meis1
4xrm_B2e-16203261563Homeobox protein Meis2
4xrm_A2e-16203261563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1896460.0AC189646.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrS009G14, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009125437.10.0PREDICTED: BEL1-like homeodomain protein 9
RefseqXP_013720155.10.0PREDICTED: BEL1-like homeodomain protein 9
SwissprotQ9LZM81e-165BLH9_ARATH; BEL1-like homeodomain protein 9
TrEMBLM4EJB70.0M4EJB7_BRARP; Uncharacterized protein
STRINGBra028883.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM56882746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.11e-157TALE family protein